PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_022638-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family BES1
Protein Properties Length: 438aa    MW: 48375.2 Da    PI: 5.677
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_022638-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822139.14.4e-43722092132
         DUF822   2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyr...kgskpl...eeaeaagssasaspe 91 
                    g +r ++ +E+E++k+RER+RR i+a+i+aGLR++Gny+l++raD+n+V++AL+reAGw+v +DGtt++   +g +p    ++a+a+ ss+ + ++
  NNU_022638-RA  72 GVRRCRPKEEKERTKLRERHRRSITARILAGLRRHGNYNLRVRADINDVIAALAREAGWIVLPDGTTFPsrnQGARPAgapSNAAATSSSHMMPVQ 167
                    6789999*************************************************************9888999999853333333344445555 PP

         DUF822  92 sslq.sslkssalaspvesysaspksssfpspssldsislas 132
                    ++   ++ +ss ++s v+  s ++ks+ +p +  ++  s++ 
  NNU_022638-RA 168 TPPAsTKGVSSGFHSTVDYRSGRMKSVFMPTSLPYQRSSSTR 209
                    665557789*********************999988876654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056876.2E-3974208IPR008540BES1/BZR1 plant transcription factor, N-terminal
SuperFamilySSF514452.0E-58252402IPR017853Glycoside hydrolase superfamily
Gene3DG3DSA:3.20.20.808.7E-69255401IPR013781Glycoside hydrolase, catalytic domain
PfamPF013733.1E-38261400IPR001554Glycoside hydrolase, family 14
PRINTSPR007505.5E-21292306IPR001554Glycoside hydrolase, family 14
PRINTSPR007505.5E-21313331IPR001554Glycoside hydrolase, family 14
PRINTSPR007505.5E-21335356IPR001554Glycoside hydrolase, family 14
PROSITE patternPS005060339347IPR018238Glycoside hydrolase, family 14, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000272Biological Processpolysaccharide catabolic process
GO:0016161Molecular Functionbeta-amylase activity
Sequence ? help Back to Top
Protein Sequence    Length: 438 aa     Download sequence    Send to blast
MTQEMEKLGG TSEEDDEEME MGVKEDVDED EDDEGKKANS ANEMAVADEG IEPNSTSQFQ  60
QQHQEQLSAS GGVRRCRPKE EKERTKLRER HRRSITARIL AGLRRHGNYN LRVRADINDV  120
IAALAREAGW IVLPDGTTFP SRNQGARPAG APSNAAATSS SHMMPVQTPP ASTKGVSSGF  180
HSTVDYRSGR MKSVFMPTSL PYQRSSSTRS RTLGMVGDKG QRIENSLLGS GADTVDGDQV  240
VDVPLKLQER DFAGTPYVPV YVMLPLGVIN MKCELVDPDG LLKQLRVLKS INVDGIMVDC  300
WWGIVEAHAP QEYNWSGYKR LFQIVRDLDF KLQVVMSFHE CGGNVGDDVC IPLPHWVAEI  360
GRNNPDIFFT DREGRRNPEC LSWGIDKERV LRGRTAVESY HSKAHVGSLR SLFLGSFLLS  420
AVGDSWFDQS SVGSSGGS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1btc_A6e-532574007150BETA-AMYLASE
1bya_A6e-5325740011154BETA-AMYLASE
1byb_A6e-5325740011154BETA-AMYLASE
1byc_A6e-5325740011154BETA-AMYLASE
1byd_A6e-5325740011154BETA-AMYLASE
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010241901.10.0PREDICTED: beta-amylase 2, chloroplastic-like
SwissprotO808311e-168BAM7_ARATH; Beta-amylase 7
TrEMBLA0A068UKR60.0A0A068UKR6_COFCA; Beta-amylase
STRINGVIT_15s0046g02640.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45880.11e-143beta-amylase 7